PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1280s0040.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 686aa    MW: 74930.6 Da    PI: 9.012
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1280s0040.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-094264631954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  SapurV1A.1280s0040.2.p 426 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 463
                             554459******************************88 PP

2BELL117.85e-38291361272
                    BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             r+elq+k++kL+++l+eVd+rY+qy++q+q+v+ssFe++ag g+ak+Yt+lAl++iSr+Fr+Lkd i++qi
  SapurV1A.1280s0040.2.p 291 RHELQMKRTKLVNMLDEVDQRYRQYHHQMQVVVSSFEQAAGFGAAKSYTALALQTISRQFRSLKDTISSQI 361
                             89********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.9E-58214359IPR006563POX domain
PfamPF075262.9E-47219358IPR006563POX domain
PROSITE profilePS5007112.131404467IPR001356Homeobox domain
SMARTSM003892.3E-9407471IPR001356Homeobox domain
CDDcd000861.42E-12407468No hitNo description
SuperFamilySSF466897.27E-17408473IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-29410473IPR009057Homeodomain-like
PfamPF059202.8E-18424463IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    Send to blast
MATYFHGSSD IQAAAAPSDG IQTLYLMNPN YLSSYSDATP QQQQSPNMIF FNHGSAAASN  60
NSLSHGPPQN HHFVGIPLPV PSSNITSLSP DNHSRPSSLH GVIPGAHYNI WGSIDQNSMA  120
SAATAIESSG AHDFMSSQVG FRRPLVVSPG RQGLSLSLSS QQAPAPPTSY SRAISHEHEI  180
QALHPHVSVV SSGDEIRLSG TSPPSVSAVS NGFSGMHNMI LGSRYLRATQ ELLDEVANVG  240
RDLIKSGFMG RTKEKMKMTK ESVTGDGSDG SGEAFGETSA KRGADLTTAH RHELQMKRTK  300
LVNMLDEVDQ RYRQYHHQMQ VVVSSFEQAA GFGAAKSYTA LALQTISRQF RSLKDTISSQ  360
IRATSKSLGE EDCIGARAEG SRLRHVDHQL RQQRALQQLG MAQHNAWRPQ RGLPERAVSV  420
LRAWLFEHFL HPYPKDSDKH MLAKQTGLTR SQVSNWFINA RVRLWKPMVE EMYLEETKER  480
EKAGSEETGS KNENKESGSQ YSSAPGETST LHMDQLKGAV LRSKQPEKTT NQNTNSPTKF  540
SNPTISMSPM GASFQQQSGF TLIGPAEMEE IAQRSSKKPR AGDMQNSPSS ILSMDMDMKQ  600
GETSREIGVS FGGERLSKDG YPLITGSNGS FGAYPMGDLG RFNIEQLTPR FSGNSVSLTL  660
GLPHLFQERS KTSSPARTFS WAVED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A8e-17413471563Homeobox protein Meis2
3k2a_B8e-17413471563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299773.20.0hypothetical protein POPTR_0001s22430g
TrEMBLB9GHM60.0B9GHM6_POPTR; Uncharacterized protein
STRINGPOPTR_0001s22430.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-105BEL1-like homeodomain 1